Lineage for d6zfea_ (6zfe A:)

  1. Root: SCOPe 2.07
  2. 2299346Class a: All alpha proteins [46456] (289 folds)
  3. 2323235Fold a.39: EF Hand-like [47472] (4 superfamilies)
    core: 4 helices; array of 2 hairpins, opened
  4. 2323236Superfamily a.39.1: EF-hand [47473] (12 families) (S)
    Duplication: consists of two EF-hand units: each is made of two helices connected with calcium-binding loop
  5. 2324762Family a.39.1.0: automated matches [191396] (1 protein)
    not a true family
  6. 2324763Protein automated matches [190513] (36 species)
    not a true protein
  7. 2324939Species Mouse (Mus musculus) [TaxId:10090] [255298] (5 PDB entries)
  8. 2324942Domain d6zfea_: 6zfe A: [401594]
    automated match to d2luca_
    complexed with ca, na, so4, zn; mutant

Details for d6zfea_

PDB Entry: 6zfe (more details), 2.35 Å

PDB Description: crystal structure of murine s100a9 mutant c80a bound to calcium and zinc
PDB Compounds: (A:) Protein S100-A9

SCOPe Domain Sequences for d6zfea_:

Sequence; same for both SEQRES and ATOM records: (download)

>d6zfea_ a.39.1.0 (A:) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
apsqmersittiidtfhqysrkeghpdtlskkefrqmveaqlatfmkkekrnealindim
edldtnqdnqlsfeeammlmaklifacheklhennprghghshgkgcg

SCOPe Domain Coordinates for d6zfea_:

Click to download the PDB-style file with coordinates for d6zfea_.
(The format of our PDB-style files is described here.)

Timeline for d6zfea_: