Lineage for d2luca_ (2luc A:)
- Root: SCOPe 2.07
Class a: All alpha proteins [46456] (289 folds) 
Fold a.39: EF Hand-like [47472] (4 superfamilies)
core: 4 helices; array of 2 hairpins, openedSuperfamily a.39.1: EF-hand [47473] (12 families) 
Duplication: consists of two EF-hand units: each is made of two helices connected with calcium-binding loop
Family a.39.1.2: S100 proteins [47478] (2 proteins)
dimer: subunits are made of two EF-hands
Protein automated matches [190132] (4 species)
not a true proteinSpecies Human (Homo sapiens) [TaxId:9606] [187203] (41 PDB entries) 
Domain d2luca_: 2luc A: [242995]
automated match to d1nsha_
Details for d2luca_
PDB Entry: 2luc (more details)
PDB Description: Solution Structure of human S100 calcium-binding protein A11
PDB Compounds: (A:) Protein S100-A11SCOPe Domain Sequences for d2luca_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2luca_ a.39.1.2 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
makisspteterciesliavfqkyagkdgynytlskteflsfmntelaaftknqkdpgvl
drmmkkldtnsdgqldfseflnligglamachdsflkavpsqkrt
SCOPe Domain Coordinates for d2luca_:
Click to download the PDB-style file with coordinates for d2luca_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d2luca_:
- d2luca_ first appeared in SCOPe 2.04
- d2luca_ appears in SCOPe 2.06
- d2luca_ appears in the current release, SCOPe 2.08
View in 3D
