SCOPe 2.08: Domain d6z5sf_: 6z5s F:

Lineage for d6z5sf_ (6z5s F:)

1. Root: SCOPe 2.08

2. Class f: Membrane and cell surface proteins and peptides [56835] (69 folds)

3. Fold f.3: Light-harvesting complex subunits [56917] (1 superfamily)
   membrane all-alpha fold

4. Superfamily f.3.1: Light-harvesting complex subunits [56918] (2 families)

5. Family f.3.1.0: automated matches [254203] (1 protein)
   not a true family

6. Protein automated matches [254444] (10 species)
   not a true protein

7. Species Rhodopseudomonas palustris [TaxId:258594] [401398] (2 PDB entries)

8. Domain d6z5sf_: 6z5s F: [401494]
   Other proteins in same PDB: d6z5sh1, d6z5sh2, d6z5sl_, d6z5sm_
   automated match to d1wrga_
   complexed with 6pl, bcl, bph, cdl, crt, fe, fme, lmt, pgt, qak, u10

Details for d6z5sf_

PDB Entry: 6z5s, 2.65 Å

PDB Description: rc-lh1(14)-w complex from rhodopseudomonas palustris

PDB Compounds: (F:) Light-harvesting complex 1 beta chain

SCOPe Domain Sequences for d6z5sf_:

Sequence; same for both SEQRES and ATOM records:

>d6z5sf_ f.3.1.0 (F:) automated matches {Rhodopseudomonas palustris [TaxId: 258594]}
sisglseaeakefhsifvtsfflfivvavvahilawmwrpwlpkatgy

Timeline for d6z5sf_:

• d6z5sf_ first appeared in SCOPe 2.07