| Class d: Alpha and beta proteins (a+b) [53931] (224 folds) |
| Fold d.85: RNA bacteriophage capsid protein [55404] (1 superfamily) 6-standed beta-sheet followed with 2 helices; meander |
Superfamily d.85.1: RNA bacteriophage capsid protein [55405] (1 family) ![]() |
| Family d.85.1.1: RNA bacteriophage capsid protein [55406] (5 proteins) |
| Protein PP7 coat protein [55415] (1 species) |
| Species Bacteriophage PP7 [TaxId:12023] [55416] (1 PDB entry) |
| Domain d1dwnc_: 1dwn C: [40143] |
PDB Entry: 1dwn (more details), 3.5 Å
SCOP Domain Sequences for d1dwnc_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1dwnc_ d.85.1.1 (C:) PP7 coat protein {Bacteriophage PP7}
sktivlsvgeatrtlteiqstadrqifeekvgplvgrlrltaslrqngaktayrvnlkld
qadvvdcstsvcgelpkvrytqvwshdvtivansteasrkslydltkslvatsqvedlvv
nlvplgr
Timeline for d1dwnc_: