Lineage for d1dwna_ (1dwn A:)

  1. Root: SCOPe 2.04
  2. 1631855Class d: Alpha and beta proteins (a+b) [53931] (380 folds)
  3. 1659798Fold d.85: RNA bacteriophage capsid protein [55404] (1 superfamily)
    6-standed beta-sheet followed with 2 helices; meander
  4. 1659799Superfamily d.85.1: RNA bacteriophage capsid protein [55405] (1 family) (S)
  5. 1659800Family d.85.1.1: RNA bacteriophage capsid protein [55406] (6 proteins)
  6. 1659932Protein PP7 coat protein [55415] (1 species)
  7. 1659933Species Bacteriophage PP7 [TaxId:12023] [55416] (1 PDB entry)
  8. 1659934Domain d1dwna_: 1dwn A: [40141]

Details for d1dwna_

PDB Entry: 1dwn (more details), 3.5 Å

PDB Description: Strucure of bacteriophage PP7 from Pseudomonas aeruginosa at 3.7 A resolution
PDB Compounds: (A:) phage coat protein

SCOPe Domain Sequences for d1dwna_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1dwna_ d.85.1.1 (A:) PP7 coat protein {Bacteriophage PP7 [TaxId: 12023]}
sktivlsvgeatrtlteiqstadrqifeekvgplvgrlrltaslrqngaktayrvnlkld
qadvvdcstsvcgelpkvrytqvwshdvtivansteasrkslydltkslvatsqvedlvv
nlvplgr

SCOPe Domain Coordinates for d1dwna_:

Click to download the PDB-style file with coordinates for d1dwna_.
(The format of our PDB-style files is described here.)

Timeline for d1dwna_: