Lineage for d1dwna_ (1dwn A:)
- Root: SCOP 1.55
Class d: Alpha and beta proteins (a+b) [53931] (184 folds) 
Fold d.85: RNA bacteriophage capsid protein [55404] (1 superfamily) Superfamily d.85.1: RNA bacteriophage capsid protein [55405] (1 family) 
Family d.85.1.1: RNA bacteriophage capsid protein [55406] (5 proteins) 
Protein PP7 coat protein [55415] (1 species) Species Bacteriophage PP7 [TaxId:12023] [55416] (1 PDB entry) 
Domain d1dwna_: 1dwn A: [40141]
Details for d1dwna_
PDB Entry: 1dwn (more details), 3.5 Å
PDB Description: Strucure of bacteriophage PP7 from Pseudomonas aeruginosa at 3.7 A resolution
SCOP Domain Sequences for d1dwna_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1dwna_ d.85.1.1 (A:) PP7 coat protein {Bacteriophage PP7}
sktivlsvgeatrtlteiqstadrqifeekvgplvgrlrltaslrqngaktayrvnlkld
qadvvdcstsvcgelpkvrytqvwshdvtivansteasrkslydltkslvatsqvedlvv
nlvplgr
SCOP Domain Coordinates for d1dwna_:
Click to download the PDB-style file with coordinates for d1dwna_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1dwna_:
- d1dwna_ appears in SCOP 1.57
- d1dwna_ appears in the current release, SCOPe 2.08
View in 3D
