Lineage for d1qbea_ (1qbe A:)
- Root: SCOP 1.59
Class d: Alpha and beta proteins (a+b) [53931] (208 folds) 
Fold d.85: RNA bacteriophage capsid protein [55404] (1 superfamily) Superfamily d.85.1: RNA bacteriophage capsid protein [55405] (1 family) 
Family d.85.1.1: RNA bacteriophage capsid protein [55406] (5 proteins) 
Protein Qbeta coat protein [55413] (1 species) Species Bacteriophage Qbeta [TaxId:39803] [55414] (1 PDB entry) 
Domain d1qbea_: 1qbe A: [40138]
Details for d1qbea_
PDB Entry: 1qbe (more details), 3.5 Å
PDB Description: bacteriophage q beta capsid
SCOP Domain Sequences for d1qbea_:
Sequence, based on SEQRES records: (download)
>d1qbea_ d.85.1.1 (A:) Qbeta coat protein {Bacteriophage Qbeta}
akletvtlgnigkdgkqtlvlnprgvnptngvaslsqagavpalekrvtvsvsqpsrnrk
nykvqvkiqnptactangscdpsvtrqayadvtfsftqystdeerafvrtelaallaspl
lidaidqlnpay
Sequence, based on observed residues (ATOM records): (download)
>d1qbea_ d.85.1.1 (A:) Qbeta coat protein {Bacteriophage Qbeta}
akletvtlgnigkdgkqtlvlnprgvnptngvaslsqagavpalekrvtvsvsqpnykvq
vkiqnptactcdpsvtrqayadvtfsftqystdeerafvrtelaallaspllidaidqln
pay
SCOP Domain Coordinates for d1qbea_:
Click to download the PDB-style file with coordinates for d1qbea_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1qbea_:
- d1qbea_ first appeared (with stable ids) in SCOP 1.55
- d1qbea_ appears in SCOP 1.57
- d1qbea_ appears in SCOP 1.61
- d1qbea_ appears in the current release, SCOPe 2.08
View in 3D
