Lineage for d6yf2a1 (6yf2 A:1-107)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2941336Fold d.26: FKBP-like [54533] (3 superfamilies)
    core: beta(2)-alpha-beta(2); antiparallel beta-sheet
  4. 2941337Superfamily d.26.1: FKBP-like [54534] (4 families) (S)
  5. 2941690Family d.26.1.0: automated matches [191631] (1 protein)
    not a true family
  6. 2941691Protein automated matches [191162] (29 species)
    not a true protein
  7. 2941753Species Human (Homo sapiens) [TaxId:9606] [225017] (17 PDB entries)
  8. 2941755Domain d6yf2a1: 6yf2 A:1-107 [401314]
    Other proteins in same PDB: d6yf2a2
    automated match to d3kz7a_
    complexed with cd, cl, na, op5

Details for d6yf2a1

PDB Entry: 6yf2 (more details), 1.03 Å

PDB Description: fkbp12 in complex with the bmp potentiator compound 6 at 1.03a resolution
PDB Compounds: (A:) Peptidyl-prolyl cis-trans isomerase FKBP1A

SCOPe Domain Sequences for d6yf2a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d6yf2a1 d.26.1.0 (A:1-107) automated matches {Human (Homo sapiens) [TaxId: 9606]}
gvqvetispgdgrtfpkrgqtcvvhytgmledgkkfdssrdrnkpfkfmlgkqevirgwe
egvaqmsvgqrakltispdyaygatghpgiipphatlvfdvellkle

SCOPe Domain Coordinates for d6yf2a1:

Click to download the PDB-style file with coordinates for d6yf2a1.
(The format of our PDB-style files is described here.)

Timeline for d6yf2a1:

View in 3D
Domains from same chain:
(mouse over for more information)
d6yf2a2