Lineage for d6yd7a1 (6yd7 A:109-442)

  1. Root: SCOPe 2.07
  2. 2434694Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2481297Fold c.41: Subtilisin-like [52742] (1 superfamily)
    3 layers: a/b/a, parallel beta-sheet of 7 strands, order 2314567; left-handed crossover connection between strands 2 & 3
  4. 2481298Superfamily c.41.1: Subtilisin-like [52743] (3 families) (S)
  5. 2481299Family c.41.1.1: Subtilases [52744] (14 proteins)
  6. 2481611Protein automated matches [190073] (16 species)
    not a true protein
  7. 2481709Species Human (Homo sapiens) [TaxId:9606] [238473] (11 PDB entries)
  8. 2481712Domain d6yd7a1: 6yd7 A:109-442 [401288]
    Other proteins in same PDB: d6yd7a2, d6yd7a3
    automated match to d1p8ja2
    complexed with 00s, 2ue, arg, ca, cl, dms, na, on8, po4, tbg

Details for d6yd7a1

PDB Entry: 6yd7 (more details), 1.8 Å

PDB Description: x-ray structure of furin in complex with the canavanine-based inhibitor 4-guanidinomethyl-phenylacetyl-arg-tle-canavanine-amba
PDB Compounds: (A:) Furin

SCOPe Domain Sequences for d6yd7a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d6yd7a1 c.41.1.1 (A:109-442) automated matches {Human (Homo sapiens) [TaxId: 9606]}
vyqeptdpkfpqqwylsgvtqrdlnvkaawaqgytghgivvsilddgieknhpdlagnyd
pgasfdvndqdpdpqprytqmndnrhgtrcagevaavanngvcgvgvaynariggvrmld
gevtdavearslglnpnhihiysaswgpeddgktvdgparlaeeaffrgvsqgrgglgsi
fvwasgnggrehdscncdgytnsiytlsissatqfgnvpwyseacsstlattyssgnqne
kqivttdlrqkcteshtgtsasaplaagiialtleanknltwrdmqhlvvqtskpahlna
ndwatngvgrkvshsygyglldagamvalaqnwt

SCOPe Domain Coordinates for d6yd7a1:

Click to download the PDB-style file with coordinates for d6yd7a1.
(The format of our PDB-style files is described here.)

Timeline for d6yd7a1: