SCOP 1.59: Domain d1gave_: 1gav E:

Lineage for d1gave_ (1gav E:)

1. Root: SCOP 1.59

2. Class d: Alpha and beta proteins (a+b) [53931] (208 folds)

3. Fold d.85: RNA bacteriophage capsid protein [55404] (1 superfamily)

4. Superfamily d.85.1: RNA bacteriophage capsid protein [55405] (1 family)

5. Family d.85.1.1: RNA bacteriophage capsid protein [55406] (5 proteins)

6. Protein GA coat protein [55409] (1 species)

7. Species Bacteriophage GA [TaxId:12018] [55410] (2 PDB entries)

8. Domain d1gave_: 1gav E: [40100]

Details for d1gave_

PDB Entry: 1gav, 3.4 Å

PDB Description: bacteriophage ga protein capsid

SCOP Domain Sequences for d1gave_:

Sequence; same for both SEQRES and ATOM records:

>d1gave_ d.85.1.1 (E:) GA coat protein {Bacteriophage GA}
atlrsfvlvdnggtgnvtvvpvsnangvaewlsnnsrsqayrvtasyrasgadkrkytik
levpkivtqvvngvelpvsawkayasidltipifaatddvtviskslaglfkvgnpiaea
issqsgfya

Timeline for d1gave_:

• d1gave_ first appeared (with stable ids) in SCOP 1.55
  
• d1gave_ appears in SCOP 1.57
  
• d1gave_ appears in SCOP 1.61
  
• d1gave_ appears in the current release, SCOPe 2.08