Lineage for d1gava_ (1gav A:)

  1. Root: SCOP 1.59
  2. 128814Class d: Alpha and beta proteins (a+b) [53931] (208 folds)
  3. 135313Fold d.85: RNA bacteriophage capsid protein [55404] (1 superfamily)
  4. 135314Superfamily d.85.1: RNA bacteriophage capsid protein [55405] (1 family) (S)
  5. 135315Family d.85.1.1: RNA bacteriophage capsid protein [55406] (5 proteins)
  6. 135324Protein GA coat protein [55409] (1 species)
  7. 135325Species Bacteriophage GA [TaxId:12018] [55410] (2 PDB entries)
  8. 135338Domain d1gava_: 1gav A: [40096]

Details for d1gava_

PDB Entry: 1gav (more details), 3.4 Å

PDB Description: bacteriophage ga protein capsid

SCOP Domain Sequences for d1gava_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1gava_ d.85.1.1 (A:) GA coat protein {Bacteriophage GA}
atlrsfvlvdnggtgnvtvvpvsnangvaewlsnnsrsqayrvtasyrasgadkrkytik
levpkivtqvvngvelpvsawkayasidltipifaatddvtviskslaglfkvgnpiaea
issqsgfya

SCOP Domain Coordinates for d1gava_:

Click to download the PDB-style file with coordinates for d1gava_.
(The format of our PDB-style files is described here.)

Timeline for d1gava_: