Lineage for d6qsus1 (6qsu S:1-105)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2928867Fold d.8: Urease, gamma-subunit [54110] (1 superfamily)
    alpha(3)-beta(2); antiparallel hairpin
  4. 2928868Superfamily d.8.1: Urease, gamma-subunit [54111] (2 families) (S)
  5. 2928869Family d.8.1.1: Urease, gamma-subunit [54112] (2 proteins)
    automatically mapped to Pfam PF00547
  6. 2928918Protein automated matches [279671] (2 species)
    not a true protein
  7. 2928919Species Helicobacter pylori [TaxId:210] [397954] (2 PDB entries)
  8. 2928941Domain d6qsus1: 6qsu S:1-105 [400840]
    Other proteins in same PDB: d6qsua2, d6qsuc2, d6qsue2, d6qsug2, d6qsui2, d6qsuk2, d6qsum2, d6qsuo2, d6qsuq2, d6qsus2, d6qsuu2, d6qsuw2
    automated match to d1e9ya2
    complexed with bme, ni

Details for d6qsus1

PDB Entry: 6qsu (more details), 2.4 Å

PDB Description: helicobacter pylori urease with bme bound in the active site
PDB Compounds: (S:) urease subunit alpha

SCOPe Domain Sequences for d6qsus1:

Sequence; same for both SEQRES and ATOM records: (download)

>d6qsus1 d.8.1.1 (S:1-105) automated matches {Helicobacter pylori [TaxId: 210]}
mkltpkeldklmlhyagelarkrkekgiklnyveavalisahimeearagkktaaelmqe
grtllkpddvmdgvasmihevgieamfpdgtklvtvhtpieangk

SCOPe Domain Coordinates for d6qsus1:

Click to download the PDB-style file with coordinates for d6qsus1.
(The format of our PDB-style files is described here.)

Timeline for d6qsus1: