Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
Fold d.8: Urease, gamma-subunit [54110] (1 superfamily) alpha(3)-beta(2); antiparallel hairpin |
Superfamily d.8.1: Urease, gamma-subunit [54111] (2 families) |
Family d.8.1.1: Urease, gamma-subunit [54112] (2 proteins) automatically mapped to Pfam PF00547 |
Protein automated matches [279671] (2 species) not a true protein |
Species Helicobacter pylori [TaxId:210] [397954] (2 PDB entries) |
Domain d6qsum1: 6qsu M:1-105 [400132] Other proteins in same PDB: d6qsua2, d6qsuc2, d6qsue2, d6qsug2, d6qsui2, d6qsuk2, d6qsum2, d6qsuo2, d6qsuq2, d6qsus2, d6qsuu2, d6qsuw2 automated match to d1e9ya2 complexed with bme, ni |
PDB Entry: 6qsu (more details), 2.4 Å
SCOPe Domain Sequences for d6qsum1:
Sequence; same for both SEQRES and ATOM records: (download)
>d6qsum1 d.8.1.1 (M:1-105) automated matches {Helicobacter pylori [TaxId: 210]} mkltpkeldklmlhyagelarkrkekgiklnyveavalisahimeearagkktaaelmqe grtllkpddvmdgvasmihevgieamfpdgtklvtvhtpieangk
Timeline for d6qsum1: