SCOPe 2.08: Domain d6tisd1: 6tis D:1-243

Lineage for d6tisd1 (6tis D:1-243)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.32: Tubulin nucleotide-binding domain-like [52489] (1 superfamily)
   3 layers: a/b/a; parallel beta-sheet of 6 strands, order 321456

4. Superfamily c.32.1: Tubulin nucleotide-binding domain-like [52490] (2 families)
   automatically mapped to Pfam PF00091

5. Family c.32.1.1: Tubulin, GTPase domain [52491] (4 proteins)

6. Protein automated matches [226837] (9 species)
   not a true protein

7. Species Fruit fly (Drosophila melanogaster) [TaxId:7227] [400541] (3 PDB entries)

8. Domain d6tisd1: 6tis D:1-243 [400542]
   Other proteins in same PDB: d6tisa2, d6tisb2, d6tisc2, d6tisd2, d6tise_
   automated match to d5bmvb1
   complexed with gdp, gol, gtp, mg, so4

Details for d6tisd1

PDB Entry: 6tis, 2.3 Å

PDB Description: drosophila gdp-tubulin

PDB Compounds: (D:) Tubulin beta-1 chain

SCOPe Domain Sequences for d6tisd1:

Sequence; same for both SEQRES and ATOM records:

>d6tisd1 c.32.1.1 (D:1-243) automated matches {Fruit fly (Drosophila melanogaster) [TaxId: 7227]}
mreivhiqagqcgnqigakfweiisdehgidatgayhgdsdlqlerinvyyneasggkyv
pravlvdlepgtmdsvrsgpfgqifrpdnfvfgqsgagnnwakghytegaelvdsvldvv
rkeaescdclqgfqlthslgggtgsgmgtlliskireeypdrimntysvvpspkvsdtvv
epynatlsvhqlventdetycidnealydicfrtlklttptygdlnhlvsltmsgvttcl
rfp

Timeline for d6tisd1:

• d6tisd1 first appeared in SCOPe 2.07