Lineage for d1spua4 (1spu A:7-90)

  1. Root: SCOPe 2.02
  2. 1190016Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 1211148Fold d.82: N domain of copper amine oxidase-like [55382] (5 superfamilies)
    alpha-beta(5)-alpha; 2 layers: alpha/beta; meander antiparallel sheet
  4. 1211149Superfamily d.82.1: Copper amine oxidase, domain N [55383] (1 family) (S)
  5. 1211150Family d.82.1.1: Copper amine oxidase, domain N [55384] (1 protein)
  6. 1211151Protein Copper amine oxidase, domain N [55385] (1 species)
    non-conserved N-terminal domain
  7. 1211152Species Escherichia coli [TaxId:562] [55386] (11 PDB entries)
  8. 1211161Domain d1spua4: 1spu A:7-90 [40011]
    Other proteins in same PDB: d1spua1, d1spua2, d1spua3, d1spub1, d1spub2, d1spub3
    complexed with ca, cu

Details for d1spua4

PDB Entry: 1spu (more details), 2 Å

PDB Description: structure of oxidoreductase
PDB Compounds: (A:) copper amine oxidase

SCOPe Domain Sequences for d1spua4:

Sequence; same for both SEQRES and ATOM records: (download)

>d1spua4 d.82.1.1 (A:7-90) Copper amine oxidase, domain N {Escherichia coli [TaxId: 562]}
mvpmdktlkefgadvqwddyaqlftlikdgayvkvkpgaqtaivngqplalqvpvvmkdn
kawvsdtfindvfqsgldqtfqve

SCOPe Domain Coordinates for d1spua4:

Click to download the PDB-style file with coordinates for d1spua4.
(The format of our PDB-style files is described here.)

Timeline for d1spua4: