![]() | Class d: Alpha and beta proteins (a+b) [53931] (376 folds) |
![]() | Fold d.82: N domain of copper amine oxidase-like [55382] (5 superfamilies) alpha-beta(5)-alpha; 2 layers: alpha/beta; meander antiparallel sheet |
![]() | Superfamily d.82.1: Copper amine oxidase, domain N [55383] (1 family) ![]() automatically mapped to Pfam PF07833 |
![]() | Family d.82.1.1: Copper amine oxidase, domain N [55384] (1 protein) |
![]() | Protein Copper amine oxidase, domain N [55385] (1 species) non-conserved N-terminal domain |
![]() | Species Escherichia coli [TaxId:562] [55386] (16 PDB entries) |
![]() | Domain d1spua4: 1spu A:7-90 [40011] Other proteins in same PDB: d1spua1, d1spua2, d1spua3, d1spub1, d1spub2, d1spub3 complexed with ca, cu |
PDB Entry: 1spu (more details), 2 Å
SCOPe Domain Sequences for d1spua4:
Sequence; same for both SEQRES and ATOM records: (download)
>d1spua4 d.82.1.1 (A:7-90) Copper amine oxidase, domain N {Escherichia coli [TaxId: 562]} mvpmdktlkefgadvqwddyaqlftlikdgayvkvkpgaqtaivngqplalqvpvvmkdn kawvsdtfindvfqsgldqtfqve
Timeline for d1spua4:
![]() Domains from other chains: (mouse over for more information) d1spub1, d1spub2, d1spub3, d1spub4 |