Lineage for d1d6za4 (1d6z A:7-90)

  1. Root: SCOPe 2.07
  2. 2530962Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2568896Fold d.82: N domain of copper amine oxidase-like [55382] (5 superfamilies)
    alpha-beta(5)-alpha; 2 layers: alpha/beta; meander antiparallel sheet
  4. 2568897Superfamily d.82.1: Copper amine oxidase, domain N [55383] (2 families) (S)
    automatically mapped to Pfam PF07833
  5. 2568898Family d.82.1.1: Copper amine oxidase, domain N [55384] (1 protein)
  6. 2568899Protein Copper amine oxidase, domain N [55385] (1 species)
    non-conserved N-terminal domain
  7. 2568900Species Escherichia coli [TaxId:562] [55386] (16 PDB entries)
  8. 2568905Domain d1d6za4: 1d6z A:7-90 [40007]
    Other proteins in same PDB: d1d6za1, d1d6za2, d1d6za3, d1d6zb1, d1d6zb2, d1d6zb3
    complexed with ca, cu, gol, hy1, pea, peo

Details for d1d6za4

PDB Entry: 1d6z (more details), 2.1 Å

PDB Description: crystal structure of the aerobically freeze trapped rate-determining catalytic intermediate of e. coli copper-containing amine oxidase.
PDB Compounds: (A:) copper amine oxidase

SCOPe Domain Sequences for d1d6za4:

Sequence; same for both SEQRES and ATOM records: (download)

>d1d6za4 d.82.1.1 (A:7-90) Copper amine oxidase, domain N {Escherichia coli [TaxId: 562]}
mvpmdktlkefgadvqwddyaqlftlikdgayvkvkpgaqtaivngqplalqvpvvmkdn
kawvsdtfindvfqsgldqtfqve

SCOPe Domain Coordinates for d1d6za4:

Click to download the PDB-style file with coordinates for d1d6za4.
(The format of our PDB-style files is described here.)

Timeline for d1d6za4: