SCOPe 2.07: Domain d1d6zb3: 1d6z B:186-300

Lineage for d1d6zb3 (1d6z B:186-300)

1. Root: SCOPe 2.07

2. Class d: Alpha and beta proteins (a+b) [53931] (388 folds)

3. Fold d.17: Cystatin-like [54402] (7 superfamilies)
   Core: alpha-beta(4); helix packs against coiled antiparallel beta-sheet

4. Superfamily d.17.2: Amine oxidase N-terminal region [54416] (2 families)

5. Family d.17.2.1: Amine oxidase N-terminal region [54417] (2 proteins)
   duplication: contains two domains of this fold

6. Protein Copper amine oxidase, domains 1 and 2 [54418] (4 species)

7. Species Escherichia coli [TaxId:562] [54419] (16 PDB entries)

8. Domain d1d6zb3: 1d6z B:186-300 [38018]
   Other proteins in same PDB: d1d6za1, d1d6za4, d1d6zb1, d1d6zb4
   complexed with ca, cu, gol, hy1, pea, peo

Details for d1d6zb3

PDB Entry: 1d6z, 2.1 Å

PDB Description: crystal structure of the aerobically freeze trapped rate-determining catalytic intermediate of e. coli copper-containing amine oxidase.

PDB Compounds: (B:) copper amine oxidase

SCOPe Domain Sequences for d1d6zb3:

Sequence; same for both SEQRES and ATOM records:

>d1d6zb3 d.17.2.1 (B:186-300) Copper amine oxidase, domains 1 and 2 {Escherichia coli [TaxId: 562]}
mvllddfasvqniinnseefaaavkkrgitdakkvittpltvgyfdgkdglkqdarllkv
isyldvgdgnywahpienlvavvdleqkkivkieegpvvpvpmtarpfdgrdrva

Timeline for d1d6zb3:

• d1d6zb3 first appeared (with stable ids) in SCOP 1.55
  
• d1d6zb3 appears in SCOPe 2.06
  
• d1d6zb3 appears in the current release, SCOPe 2.08