Lineage for d1dapa2 (1dap A:119-268)

  1. Root: SCOPe 2.06
  2. 2170735Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2203126Fold d.81: FwdE/GAPDH domain-like [55346] (4 superfamilies)
    core: alpha-beta-alpha-beta(3); mixed sheet: 2134, strand 2 is parallel to strand 1
  4. 2203127Superfamily d.81.1: Glyceraldehyde-3-phosphate dehydrogenase-like, C-terminal domain [55347] (5 families) (S)
    N-terminal domain is the classic Rossmann-fold
  5. 2203521Family d.81.1.3: Dihydrodipicolinate reductase-like [55368] (6 proteins)
  6. 2203554Protein Diaminopimelic acid dehydrogenase (DAPDH) [55369] (1 species)
    distantly related to dihydrodipicolinate reductase
    larger alpha+beta subdomain substitutes for one helix and one strand of the common fold
  7. 2203555Species Corynebacterium glutamicum [TaxId:1718] [55370] (4 PDB entries)
  8. 2203561Domain d1dapa2: 1dap A:119-268 [39968]
    Other proteins in same PDB: d1dapa1, d1dapb1
    complexed with act, ndp

Details for d1dapa2

PDB Entry: 1dap (more details), 2.2 Å

PDB Description: c. glutamicum dap dehydrogenase in complex with nadp+
PDB Compounds: (A:) diaminopimelic acid dehydrogenase

SCOPe Domain Sequences for d1dapa2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1dapa2 d.81.1.3 (A:119-268) Diaminopimelic acid dehydrogenase (DAPDH) {Corynebacterium glutamicum [TaxId: 1718]}
wdpgmfsinrvyaaavlaehqqhtfwgpglsqghsdalrripgvqkavqytlpsedalek
arrgeagdltgkqthkrqcfvvadaadheriendirtmpdyfvgyevevnfideatfdse
htgmphgghvittgdtggfnhtveyilkld

SCOPe Domain Coordinates for d1dapa2:

Click to download the PDB-style file with coordinates for d1dapa2.
(The format of our PDB-style files is described here.)

Timeline for d1dapa2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1dapa1