Class a: All alpha proteins [46456] (290 folds) |
Fold a.25: Ferritin-like [47239] (6 superfamilies) core: 4 helices; bundle, closed, left-handed twist; 1 crossover connection |
Superfamily a.25.1: Ferritin-like [47240] (10 families) contains bimetal-ion centre in the middle of the bundle |
Family a.25.1.1: Ferritin [47241] (10 proteins) |
Protein automated matches [190041] (34 species) not a true protein |
Species Phascolosoma esculenta [TaxId:419950] [399640] (2 PDB entries) |
Domain d6lpdf_: 6lpd F: [399654] automated match to d5xhoa_ complexed with fe, fe2 |
PDB Entry: 6lpd (more details), 1.65 Å
SCOPe Domain Sequences for d6lpdf_:
Sequence; same for both SEQRES and ATOM records: (download)
>d6lpdf_ a.25.1.1 (F:) automated matches {Phascolosoma esculenta [TaxId: 419950]} slsrprqnyhtesesavnkqinlelyasyvyqsmsryfnrddvalkgfhkyfkkaseeer qhaeklmeyqstrggrimlsdikrpendewgtgleametalnleknvnqslldlhktaek hvdaqmqdfieenflreqvesikeisdhitnlkrvgpglgeymfdknlse
Timeline for d6lpdf_: