Lineage for d6lpdf_ (6lpd F:)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2700837Fold a.25: Ferritin-like [47239] (6 superfamilies)
    core: 4 helices; bundle, closed, left-handed twist; 1 crossover connection
  4. 2700838Superfamily a.25.1: Ferritin-like [47240] (10 families) (S)
    contains bimetal-ion centre in the middle of the bundle
  5. 2700839Family a.25.1.1: Ferritin [47241] (10 proteins)
  6. 2702255Protein automated matches [190041] (34 species)
    not a true protein
  7. 2702778Species Phascolosoma esculenta [TaxId:419950] [399640] (2 PDB entries)
  8. 2702784Domain d6lpdf_: 6lpd F: [399654]
    automated match to d5xhoa_
    complexed with fe, fe2

Details for d6lpdf_

PDB Entry: 6lpd (more details), 1.65 Å

PDB Description: phascolosoma esculenta
PDB Compounds: (F:) Ferritin

SCOPe Domain Sequences for d6lpdf_:

Sequence; same for both SEQRES and ATOM records: (download)

>d6lpdf_ a.25.1.1 (F:) automated matches {Phascolosoma esculenta [TaxId: 419950]}
slsrprqnyhtesesavnkqinlelyasyvyqsmsryfnrddvalkgfhkyfkkaseeer
qhaeklmeyqstrggrimlsdikrpendewgtgleametalnleknvnqslldlhktaek
hvdaqmqdfieenflreqvesikeisdhitnlkrvgpglgeymfdknlse

SCOPe Domain Coordinates for d6lpdf_:

Click to download the PDB-style file with coordinates for d6lpdf_.
(The format of our PDB-style files is described here.)

Timeline for d6lpdf_: