SCOPe 2.08: Domain d7l6cd_: 7l6c D:

Lineage for d7l6cd_ (7l6c D:)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)
   core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456
   The nucleotide-binding modes of this and the next two folds/superfamilies are similar

4. Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families)

5. Family c.2.1.2: Tyrosine-dependent oxidoreductases [51751] (73 proteins)
   also known as short-chain dehydrogenases and SDR family
   parallel beta-sheet is extended by 7th strand, order 3214567; left-handed crossover connection between strands 6 and 7
   has additional subdomain(s) that are not in the common domain
   

6. Protein automated matches [190085] (59 species)
   not a true protein

7. Species Mycobacteroides abscessus [TaxId:561007] [394955] (2 PDB entries)

8. Domain d7l6cd_: 7l6c D: [399448]
   automated match to d2h9ia_
   complexed with edo, na, nad

Details for d7l6cd_

PDB Entry: 7l6c, 1.85 Å

PDB Description: crystal structure of enoyl-[acyl-carrier-protein] reductase inha from mycobacterium abscessus in complex with nad

PDB Compounds: (D:) Enoyl-[acyl-carrier-protein] reductase [NADH]

SCOPe Domain Sequences for d7l6cd_:

Sequence, based on SEQRES records:

>d7l6cd_ c.2.1.2 (D:) automated matches {Mycobacteroides abscessus [TaxId: 561007]}
gllegkrilvtgiitdssiafhiakvaqeqgaelvltgfdrlrlieritqrlpkpaplle
ldvqneehlgslagrisevigegnkldgvvhsigfmpqsgmgvnpffdapfadvskgfhi
safsysslakavlpvmnrggsivgmdfdptrampaynwmtvaksalesvnrfvareagkv
gvrsnlvaagpirtlamsaivggalgdeagqqmqlleegwdqrapigwdmkdptpvaktv
callsdwlpattgdiifadggahtqll

Sequence, based on observed residues (ATOM records):

>d7l6cd_ c.2.1.2 (D:) automated matches {Mycobacteroides abscessus [TaxId: 561007]}
gllegkrilvtgiitdssiafhiakvaqeqgaelvltgfdrlrlieritqrlpkpaplle
ldvqneehlgslagrisevigegnkldgvvhsigfmpqsgmgvnpffdapfadvskgfhi
safsysslakavlpvmnrggsivgmdfdptrampaynwmtvaksalesvnrfvareagkv
gvrsnlvaagpirtlamsaivalgdeagqqmqlleegwdqrapigwdmkdptpvaktvca
llsdwlpattgdiifadggahtqll

Timeline for d7l6cd_:

• d7l6cd_ first appeared in SCOPe 2.07