SCOPe 2.07: Domain d7jy5c1: 7jy5 C:12-106

Lineage for d7jy5c1 (7jy5 C:12-106)

1. Root: SCOPe 2.07

2. Class b: All beta proteins [48724] (178 folds)

3. Fold b.52: Double psi beta-barrel [50684] (2 superfamilies)
   barrel, closed; n=6, S=10; complex topology with crossover (psi) loops

4. Superfamily b.52.2: ADC-like [50692] (4 families)

5. Family b.52.2.3: Cdc48 N-terminal domain-like [50708] (4 proteins)

6. Protein Membrane fusion ATPase p97 N-terminal domain , P97-Nn [63796] (2 species)

7. Species Human (Homo sapiens) [TaxId:9606] [233316] (13 PDB entries)

8. Domain d7jy5c1: 7jy5 C:12-106 [399052]
   Other proteins in same PDB: d7jy5a2, d7jy5a3, d7jy5a4, d7jy5b2, d7jy5b3, d7jy5b4, d7jy5c2, d7jy5c3, d7jy5c4, d7jy5d2, d7jy5d3, d7jy5d4, d7jy5e2, d7jy5e3, d7jy5e4, d7jy5f2, d7jy5f3, d7jy5f4
   automated match to d3cf1a1
   complexed with ags, mg

Details for d7jy5c1

PDB Entry: 7jy5, 2.89 Å

PDB Description: structure of human p97 in complex with atpgammas and npl4/ufd1 (masked around p97)

PDB Compounds: (C:) Transitional endoplasmic reticulum ATPase

SCOPe Domain Sequences for d7jy5c1:

Sequence; same for both SEQRES and ATOM records:

>d7jy5c1 b.52.2.3 (C:12-106) Membrane fusion ATPase p97 N-terminal domain , P97-Nn {Human (Homo sapiens) [TaxId: 9606]}
lstailkqknrpnrlivdeainednsvvslsqpkmdelqlfrgdtvllkgkkrreavciv
lsddtcsdekirmnrvvrnnlrvrlgdvisiqpcp

Timeline for d7jy5c1:

• d7jy5c1 is new in SCOPe 2.07-stable
  
• d7jy5c1 appears in the current release, SCOPe 2.08