Lineage for d7jy5a3 (7jy5 A:201-470)

  1. Root: SCOPe 2.07
  2. 2434694Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2473887Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
    3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes
  4. 2473888Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (26 families) (S)
    division into families based on beta-sheet topologies
  5. 2479032Family c.37.1.20: Extended AAA-ATPase domain [81269] (42 proteins)
    fold is similar to that of RecA, but lacks the last two strands, followed by a family-specific Arg-finger domain
  6. 2479239Protein Membrane fusion ATPase VCP/p97 [64038] (2 species)
  7. 2479240Species Human (Homo sapiens) [TaxId:9606] [313486] (5 PDB entries)
  8. 2479266Domain d7jy5a3: 7jy5 A:201-470 [399020]
    Other proteins in same PDB: d7jy5a1, d7jy5a2, d7jy5b1, d7jy5b2, d7jy5c1, d7jy5c2, d7jy5d1, d7jy5d2, d7jy5e1, d7jy5e2, d7jy5f1, d7jy5f2
    automated match to d3cf1a2
    complexed with ags, mg

Details for d7jy5a3

PDB Entry: 7jy5 (more details), 2.89 Å

PDB Description: structure of human p97 in complex with atpgammas and npl4/ufd1 (masked around p97)
PDB Compounds: (A:) Transitional endoplasmic reticulum ATPase

SCOPe Domain Sequences for d7jy5a3:

Sequence; same for both SEQRES and ATOM records: (download)

>d7jy5a3 c.37.1.20 (A:201-470) Membrane fusion ATPase VCP/p97 {Human (Homo sapiens) [TaxId: 9606]}
vgyddiggcrkqlaqikemvelplrhpalfkaigvkpprgillygppgtgktliaravan
etgaffflingpeimsklagesesnlrkafeeaeknapaiifideldaiapkrekthgev
errivsqlltlmdglkqrahvivmaatnrpnsidpalrrfgrfdrevdigipdatgrlei
lqihtknmkladdvdleqvanethghvgadlaalcseaalqairkkmdlidledetidae
vmnslavtmddfrwalsqsnpsalretvve

SCOPe Domain Coordinates for d7jy5a3:

Click to download the PDB-style file with coordinates for d7jy5a3.
(The format of our PDB-style files is described here.)

Timeline for d7jy5a3: