Class a: All alpha proteins [46456] (290 folds) |
Fold a.1: Globin-like [46457] (2 superfamilies) core: 6 helices; folded leaf, partly opened |
Superfamily a.1.1: Globin-like [46458] (5 families) |
Family a.1.1.2: Globins [46463] (27 proteins) Heme-binding protein |
Protein Myoglobin [46469] (11 species) |
Species Horse (Equus caballus) [TaxId:9796] [46474] (96 PDB entries) |
Domain d7dglb_: 7dgl B: [398824] automated match to d3vm9a_ complexed with hem, ni, o |
PDB Entry: 7dgl (more details), 1.91 Å
SCOPe Domain Sequences for d7dglb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d7dglb_ a.1.1.2 (B:) Myoglobin {Horse (Equus caballus) [TaxId: 9796]} glsdgewqqvlnvwgkveadiaghgqevlirlftghpetlekfdkfkhlkteaemkased lkkhgtvvltalggilkhkahaeaelkplaqshatkhkipikylefisdaiihvlhskhp gdfgadaqgamtkalelfrndiaakykelgfqg
Timeline for d7dglb_: