SCOPe 2.08: Domain d7c52m_: 7c52 M:

Lineage for d7c52m_ (7c52 M:)

1. Root: SCOPe 2.08

2. Class f: Membrane and cell surface proteins and peptides [56835] (69 folds)

3. Fold f.26: Bacterial photosystem II reaction centre, L and M subunits [81484] (1 superfamily)
   five transmembrane helices forming a sheet-like structure

4. Superfamily f.26.1: Bacterial photosystem II reaction centre, L and M subunits [81483] (1 family)
   automatically mapped to Pfam PF00124

5. Family f.26.1.1: Bacterial photosystem II reaction centre, L and M subunits [81482] (5 proteins)
   L and M are probably related to each other

6. Protein automated matches [190224] (17 species)
   not a true protein

7. Species Thermochromatium tepidum [TaxId:1050] [267912] (5 PDB entries)

8. Domain d7c52m_: 7c52 M: [398607]
   Other proteins in same PDB: d7c520_, d7c521_, d7c522_, d7c523_, d7c524_, d7c525_, d7c526_, d7c527_, d7c528_, d7c529_, d7c52a_, d7c52b_, d7c52c_, d7c52d_, d7c52e_, d7c52f_, d7c52g_, d7c52h1, d7c52h2, d7c52i_, d7c52j_, d7c52k_, d7c52n_, d7c52o_, d7c52p_, d7c52q_, d7c52r_, d7c52s_, d7c52t_, d7c52u_, d7c52v_, d7c52w_, d7c52x_, d7c52y_, d7c52z_
   automated match to d3wmmm_
   complexed with bcl, bph, ca, cdl, crt, fe, gol, hem, lhg, lmt, mq8, pef, pgv, sf4, so4, uq8

Details for d7c52m_

PDB Entry: 7c52, 2.89 Å

PDB Description: co-crystal structure of a photosynthetic lh1-rc in complex with electron donor hipip

PDB Compounds: (M:) Photosynthetic reaction center M subunit

SCOPe Domain Sequences for d7c52m_:

Sequence; same for both SEQRES and ATOM records:

>d7c52m_ f.26.1.1 (M:) automated matches {Thermochromatium tepidum [TaxId: 1050]}
peyqniftavqvrapaypgvplpkgnlprigrpifsywlgkigdaqigpiylgltgtlsi
ffglvaisiigfnmlasvhwdvfqflkhffwlgleppppqyglripplseggwwlmaglf
ltlsillwwvrtykraealgmsqhlswafaaaiffylvlgfirpvmmgswakavpfgifp
hldwtaafsirygnlyynpfhmlsiaflygsallfamhgatilsvsrfggdreidqithr
gtaaeraalfwrwtmgfnvtmesihrwawwcavltvitagigillsgtvvdnwylwavkh
gmapaypevvtavnpyet

Timeline for d7c52m_:

• d7c52m_ first appeared in SCOPe 2.07