Lineage for d7btkb5 (7btk B:731-1023)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2781474Fold b.30: Supersandwich [49993] (3 superfamilies)
    sandwich; 18 strands in 2 sheets
  4. 2781620Superfamily b.30.5: Galactose mutarotase-like [74650] (12 families) (S)
    probable carbohydrate-binding domain in enzymes acting on sugars
  5. 2781621Family b.30.5.1: beta-Galactosidase, domain 5 [49995] (1 protein)
    automatically mapped to Pfam PF02929
  6. 2781622Protein beta-Galactosidase, domain 5 [49996] (2 species)
  7. 2781630Species Escherichia coli [TaxId:562] [49997] (46 PDB entries)
    Uniprot P00722
  8. 2781780Domain d7btkb5: 7btk B:731-1023 [398520]
    Other proteins in same PDB: d7btka1, d7btka2, d7btka3, d7btka4, d7btkb1, d7btkb2, d7btkb3, d7btkb4, d7btkc1, d7btkc2, d7btkc3, d7btkc4, d7btkd1, d7btkd2, d7btkd3, d7btkd4
    automated match to d1jz8a4
    complexed with dms, f6l, gol, mg, na

Details for d7btkb5

PDB Entry: 7btk (more details), 2.7 Å

PDB Description: e.coli beta-galactosidase (e537q) in complex with fluorescent probe ksa01
PDB Compounds: (B:) beta-galactosidase

SCOPe Domain Sequences for d7btkb5:

Sequence; same for both SEQRES and ATOM records: (download)

>d7btkb5 b.30.5.1 (B:731-1023) beta-Galactosidase, domain 5 {Escherichia coli [TaxId: 562]}
paashaiphlttsemdfcielgnkrwqfnrqsgflsqmwigdkkqlltplrdqftrapld
ndigvseatridpnawverwkaaghyqaeaallqctadtladavlittahawqhqgktlf
isrktyridgsgqmaitvdvevasdtphpariglncqlaqvaervnwlglgpqenypdrl
taacfdrwdlplsdmytpyvfpsenglrcgtrelnygphqwrgdfqfnisrysqqqlmet
shrhllhaeegtwlnidgfhmgiggddswspsvsaefqlsagryhyqlvwcqk

SCOPe Domain Coordinates for d7btkb5:

Click to download the PDB-style file with coordinates for d7btkb5.
(The format of our PDB-style files is described here.)

Timeline for d7btkb5: