Class b: All beta proteins [48724] (180 folds) |
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.4: beta-Galactosidase/glucuronidase domain [49303] (2 families) |
Family b.1.4.1: beta-Galactosidase/glucuronidase domain [49304] (4 proteins) |
Protein beta-Galactosidase, domains 2 and 4 [49305] (3 species) |
Species Escherichia coli [TaxId:562] [49306] (46 PDB entries) Uniprot P00722 |
Domain d7btkb4: 7btk B:626-730 [398519] Other proteins in same PDB: d7btka1, d7btka3, d7btka5, d7btkb1, d7btkb3, d7btkb5, d7btkc1, d7btkc3, d7btkc5, d7btkd1, d7btkd3, d7btkd5 automated match to d1jz8a2 complexed with dms, f6l, gol, mg, na |
PDB Entry: 7btk (more details), 2.7 Å
SCOPe Domain Sequences for d7btkb4:
Sequence; same for both SEQRES and ATOM records: (download)
>d7btkb4 b.1.4.1 (B:626-730) beta-Galactosidase, domains 2 and 4 {Escherichia coli [TaxId: 562]} ffqfrlsgqtievtseylfrhsdnellhwmvaldgkplasgevpldvapqgkqlielpel pqpesagqlwltvrvvqpnatawseaghisawqqwrlaenlsvtl
Timeline for d7btkb4:
View in 3D Domains from same chain: (mouse over for more information) d7btkb1, d7btkb2, d7btkb3, d7btkb5 |