Lineage for d7btkd4 (7btk D:626-730)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2739517Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2762430Superfamily b.1.4: beta-Galactosidase/glucuronidase domain [49303] (2 families) (S)
  5. 2762431Family b.1.4.1: beta-Galactosidase/glucuronidase domain [49304] (4 proteins)
  6. 2762432Protein beta-Galactosidase, domains 2 and 4 [49305] (3 species)
  7. 2762446Species Escherichia coli [TaxId:562] [49306] (46 PDB entries)
    Uniprot P00722
  8. 2762750Domain d7btkd4: 7btk D:626-730 [398538]
    Other proteins in same PDB: d7btka1, d7btka3, d7btka5, d7btkb1, d7btkb3, d7btkb5, d7btkc1, d7btkc3, d7btkc5, d7btkd1, d7btkd3, d7btkd5
    automated match to d1jz8a2
    complexed with dms, f6l, gol, mg, na

Details for d7btkd4

PDB Entry: 7btk (more details), 2.7 Å

PDB Description: e.coli beta-galactosidase (e537q) in complex with fluorescent probe ksa01
PDB Compounds: (D:) beta-galactosidase

SCOPe Domain Sequences for d7btkd4:

Sequence; same for both SEQRES and ATOM records: (download)

>d7btkd4 b.1.4.1 (D:626-730) beta-Galactosidase, domains 2 and 4 {Escherichia coli [TaxId: 562]}
ffqfrlsgqtievtseylfrhsdnellhwmvaldgkplasgevpldvapqgkqlielpel
pqpesagqlwltvrvvqpnatawseaghisawqqwrlaenlsvtl

SCOPe Domain Coordinates for d7btkd4:

Click to download the PDB-style file with coordinates for d7btkd4.
(The format of our PDB-style files is described here.)

Timeline for d7btkd4: