![]() | Class d: Alpha and beta proteins (a+b) [53931] (234 folds) |
![]() | Fold d.79: Bacillus chorismate mutase-like [55297] (5 superfamilies) core: beta-alpha-beta-alpha-beta(2); mixed beta-sheet: order: 1423, strand 4 is antiparallel to the rest |
![]() | Superfamily d.79.4: Aminoimidazole ribonucleotide synthetase (PurM) N-terminal domain [55326] (1 family) ![]() |
![]() | Family d.79.4.1: Aminoimidazole ribonucleotide synthetase (PurM) N-terminal domain [55327] (1 protein) |
![]() | Protein Aminoimidazole ribonucleotide synthetase (PurM) N-terminal domain [55328] (1 species) |
![]() | Species Escherichia coli [TaxId:562] [55329] (1 PDB entry) |
![]() | Domain d1clid1: 1cli D:3021-3170 [39819] Other proteins in same PDB: d1clia2, d1clib2, d1clic2, d1clid2 complexed with so4 |
PDB Entry: 1cli (more details), 2.5 Å
SCOP Domain Sequences for d1clid1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1clid1 d.79.4.1 (D:3021-3170) Aminoimidazole ribonucleotide synthetase (PurM) N-terminal domain {Escherichia coli} alvgrikgvvkktrrpevmgglggfgalcalpqkyrepvlvsgtdgvgtklrlamdlkrh dtigidlvamcvndlvvqgaeplffldyyatgkldvdtasavisgiaegclqsgcslvgg etaempgmyhgedydvagfcvgvvekseii
Timeline for d1clid1: