![]() | Class d: Alpha and beta proteins (a+b) [53931] (234 folds) |
![]() | Fold d.139: Aminoimidazole ribonucleotide synthetase (PurM) C-terminal domain [56041] (1 superfamily) 3 layers: alpha/beta/alpha; partial topological similarity to the ferredoxin-like fold |
![]() | Superfamily d.139.1: Aminoimidazole ribonucleotide synthetase (PurM) C-terminal domain [56042] (1 family) ![]() |
![]() | Family d.139.1.1: Aminoimidazole ribonucleotide synthetase (PurM) C-terminal domain [56043] (1 protein) |
![]() | Protein Aminoimidazole ribonucleotide synthetase (PurM) C-terminal domain [56044] (1 species) |
![]() | Species Escherichia coli [TaxId:562] [56045] (1 PDB entry) |
![]() | Domain d1clid2: 1cli D:3171-3345 [41462] Other proteins in same PDB: d1clia1, d1clib1, d1clic1, d1clid1 complexed with so4 |
PDB Entry: 1cli (more details), 2.5 Å
SCOP Domain Sequences for d1clid2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1clid2 d.139.1.1 (D:3171-3345) Aminoimidazole ribonucleotide synthetase (PurM) C-terminal domain {Escherichia coli} dgskvsdgdvlialgssgphsngyslvrkilevsgcdpqtteldgkpladhllaptriyv ksvleliekvdvhaiahltgggfweniprvlpdntqavidesswqwpevfnwlqtagnve hhemyrtfncgvgmiialpapevdkalallnangenawkigiikasdseqrvvie
Timeline for d1clid2: