SCOPe 2.08: Domain d7aacb1: 7aac B:662-796

Lineage for d7aacb1 (7aac B:662-796)

1. Root: SCOPe 2.08

2. Class a: All alpha proteins [46456] (290 folds)

3. Fold a.41: Domain of poly(ADP-ribose) polymerase [47586] (1 superfamily)
   core: 4 helices: bundle; unusual topology

4. Superfamily a.41.1: Domain of poly(ADP-ribose) polymerase [47587] (2 families)
   duplication: consists of 2 helix-loop-helix structural repeats
   automatically mapped to Pfam PF02877

5. Family a.41.1.0: automated matches [227223] (1 protein)
   not a true family

6. Protein automated matches [226964] (2 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [225405] (62 PDB entries)

8. Domain d7aacb1: 7aac B:662-796 [398174]
   Other proteins in same PDB: d7aaca2, d7aacb2
   automated match to d4hhyd1
   complexed with 78p, so4

Details for d7aacb1

PDB Entry: 7aac, 1.59 Å

PDB Description: crystal structure of the catalytic domain of human parp1 in complex with veliparib

PDB Compounds: (B:) Poly [ADP-ribose] polymerase 1

SCOPe Domain Sequences for d7aacb1:

Sequence; same for both SEQRES and ATOM records:

>d7aacb1 a.41.1.0 (B:662-796) automated matches {Human (Homo sapiens) [TaxId: 9606]}
ksklpkpvqdlikmifdvesmkkamveyeidlqkmplgklskrqiqaaysilsevqqavs
qgssdsqildlsnrfytliphdfgmkkppllnnadsvqakaemldnlldievaysllrgg
sddsskdpidvnyek

Timeline for d7aacb1:

• d7aacb1 first appeared in SCOPe 2.07