Lineage for d6yzza_ (6yzz A:)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2968378Fold d.108: Acyl-CoA N-acyltransferases (Nat) [55728] (1 superfamily)
    3 layers: a/b/a; contains mixed beta-sheet
  4. 2968379Superfamily d.108.1: Acyl-CoA N-acyltransferases (Nat) [55729] (12 families) (S)
  5. 2968970Family d.108.1.0: automated matches [191308] (1 protein)
    not a true family
  6. 2968971Protein automated matches [190038] (49 species)
    not a true protein
  7. 2969482Species Thale cress (Arabidopsis thaliana) [TaxId:3702] [195601] (3 PDB entries)
  8. 2969486Domain d6yzza_: 6yzz A: [397940]
    automated match to d4lx9a_
    complexed with aco

Details for d6yzza_

PDB Entry: 6yzz (more details), 1.79 Å

PDB Description: arabidopsis thaliana naa50 in complex with accoa
PDB Compounds: (A:) N-alpha-acetyltransferase 50

SCOPe Domain Sequences for d6yzza_:

Sequence; same for both SEQRES and ATOM records: (download)

>d6yzza_ d.108.1.0 (A:) automated matches {Thale cress (Arabidopsis thaliana) [TaxId: 3702]}
vsvsldgvrdknlmqlkilntvlfpvryndkyyadaiaageftklayyndicvgaiacrl
ekkesgamrvyimtlgvlapyrgigigsnllnhvldmcskqnmceiylhvqtnnedaikf
ykkfgfeitdtiqnyyinieprdcyvvsksf

SCOPe Domain Coordinates for d6yzza_:

Click to download the PDB-style file with coordinates for d6yzza_.
(The format of our PDB-style files is described here.)

Timeline for d6yzza_: