SCOPe 2.07: Domain d6wmba2: 6wmb A:195-382

Lineage for d6wmba2 (6wmb A:195-382)

1. Root: SCOPe 2.07

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.97: Cytidine deaminase-like [53926] (2 superfamilies)
   core: alpha-beta(2)-(alpha-beta)2; 3 layers (a/b/a); mixed beta-sheet of 4 strands, order 2134; strand 1 is antiparallel to the rest

4. Superfamily c.97.1: Cytidine deaminase-like [53927] (7 families)
   contains extra C-terminal strand 5, order 21345

5. Family c.97.1.6: apolipoprotein B messenger RNA-editing enzyme catalytic (APOBEC) cytidine deaminase domains [310632] (5 proteins)
   strand 5 is parallel to strand 4
   Pfam PF08210; Pfam PF05240

6. Protein automated matches [310855] (2 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [311219] (22 PDB entries)

8. Domain d6wmba2: 6wmb A:195-382 [397914]
   Other proteins in same PDB: d6wmba3
   automated match to d5hx4a_
   protein/DNA complex; complexed with zn

Details for d6wmba2

PDB Entry: 6wmb, 3.02 Å

PDB Description: crystal structure of a soluble variant of full-length human apobec3g (ph 8.0)

PDB Compounds: (A:) apolipoprotein b mRNA editing enzyme, catalytic peptide- like 3g

SCOPe Domain Sequences for d6wmba2:

Sequence, based on SEQRES records:

>d6wmba2 c.97.1.6 (A:195-382) automated matches {Human (Homo sapiens) [TaxId: 9606]}
hsmdaatftfnfnnepwvrgrhetylcyevermhndtwvklaqrrgflanqakhkhgfle
grhaalcfldvipfwkldldqdyrvtcftswspcfscaqemakfisknkhvslciktari
yddkgraaeglrtlaeagakisimtysefkhcwdtfvdhqgapfqpwdgldehsqdlsgr
lrailqnq

Sequence, based on observed residues (ATOM records):

>d6wmba2 c.97.1.6 (A:195-382) automated matches {Human (Homo sapiens) [TaxId: 9606]}
hsmdaatftfnfnnepwvrgrhetylcyevermhndtwvklaqrrgflanqaklegrhaa
lcfldvipfwkldldqdyrvtcftswspcfscaqemakfisknkhvslciktariyddkg
raaeglrtlaeagakisimtysefkhcwdtfvdhqgapfqpwdgldehsqdlsgrlrail
qnq

Timeline for d6wmba2:

• d6wmba2 is new in SCOPe 2.07-stable
  
• d6wmba2 appears in the current release, SCOPe 2.08