Lineage for d1qkla_ (1qkl A:)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2734750Fold a.143: RPB6/omega subunit-like [63561] (1 superfamily)
    core: 2 helices and adjacent loops
  4. 2734751Superfamily a.143.1: RPB6/omega subunit-like [63562] (2 families) (S)
    the bacterial omega and eukaryotic RPB6 subunits both function in polymerase assembly; the common core is involved in conserved interactions with other subunits
  5. 2734802Family a.143.1.2: RPB6 [55294] (2 proteins)
  6. 2734803Protein RPB6 [55295] (3 species)
    essential subunit of RNA polymerases I, II and III
  7. 2734840Species Human (Homo sapiens) [TaxId:9606] [55296] (1 PDB entry)
  8. 2734841Domain d1qkla_: 1qkl A: [39754]

Details for d1qkla_

PDB Entry: 1qkl (more details)

PDB Description: hrpabc14.4, essential subunit of human rna polymerases i, ii and iii
PDB Compounds: (A:) DNA-directed RNA polymerase II 14.4 kd polypeptide

SCOPe Domain Sequences for d1qkla_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1qkla_ a.143.1.2 (A:) RPB6 {Human (Homo sapiens) [TaxId: 9606]}
msdnednfdgddfddveedeglddlenaeeegqenveilpsgerpqanqkrittpymtky
erarvlgtralqiamcapvmvelegetdplliamkelkarkipiiirrylpdgsyedwgv
deliitd

SCOPe Domain Coordinates for d1qkla_:

Click to download the PDB-style file with coordinates for d1qkla_.
(The format of our PDB-style files is described here.)

Timeline for d1qkla_: