Class b: All beta proteins [48724] (180 folds) |
Fold b.62: Cyclophilin-like [50890] (1 superfamily) barrel, closed; n=8, S=10; complex topology |
Superfamily b.62.1: Cyclophilin-like [50891] (5 families) |
Family b.62.1.1: Cyclophilin (peptidylprolyl isomerase) [50892] (13 proteins) automatically mapped to Pfam PF00160 |
Protein automated matches [190077] (22 species) not a true protein |
Species Thale cress (Arabidopsis thaliana) [TaxId:3702] [397210] (1 PDB entry) |
Domain d6lkba_: 6lkb A: [397220] automated match to d2a2nc_ complexed with co, gol, po4, so4 |
PDB Entry: 6lkb (more details), 1.65 Å
SCOPe Domain Sequences for d6lkba_:
Sequence; same for both SEQRES and ATOM records: (download)
>d6lkba_ b.62.1.1 (A:) automated matches {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} sattslpenvimhttlgdihmklypeecpktvenftthcrngyydnhlfhrvirgfmiqt gdplgdgtggqsiwgrefedefhkslrhdrpftlsmanagpntngsqffittvatpwldn khtvfgrvvkgmdvvqgiekvktdkndrpyqdvkilnvtv
Timeline for d6lkba_: