SCOPe 2.08: Domain d6lkba_: 6lkb A:

Lineage for d6lkba_ (6lkb A:)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.62: Cyclophilin-like [50890] (1 superfamily)
   barrel, closed; n=8, S=10; complex topology

4. Superfamily b.62.1: Cyclophilin-like [50891] (5 families)

5. Family b.62.1.1: Cyclophilin (peptidylprolyl isomerase) [50892] (13 proteins)
   automatically mapped to Pfam PF00160

6. Protein automated matches [190077] (22 species)
   not a true protein

7. Species Thale cress (Arabidopsis thaliana) [TaxId:3702] [397210] (1 PDB entry)

8. Domain d6lkba_: 6lkb A: [397220]
   automated match to d2a2nc_
   complexed with co, gol, po4, so4

Details for d6lkba_

PDB Entry: 6lkb, 1.65 Å

PDB Description: crystal structure of the peptidylprolyl isomerase domain of arabidopsis thaliana cyp71.

PDB Compounds: (A:) Peptidyl-prolyl cis-trans isomerase CYP71

SCOPe Domain Sequences for d6lkba_:

Sequence; same for both SEQRES and ATOM records:

>d6lkba_ b.62.1.1 (A:) automated matches {Thale cress (Arabidopsis thaliana) [TaxId: 3702]}
sattslpenvimhttlgdihmklypeecpktvenftthcrngyydnhlfhrvirgfmiqt
gdplgdgtggqsiwgrefedefhkslrhdrpftlsmanagpntngsqffittvatpwldn
khtvfgrvvkgmdvvqgiekvktdkndrpyqdvkilnvtv

Timeline for d6lkba_:

• d6lkba_ first appeared in SCOPe 2.07