Class d: Alpha and beta proteins (a+b) [53931] (388 folds) |
Fold d.74: DCoH-like [55247] (5 superfamilies) beta(2)-alpha-beta(2)-alpha; 2 layers, alpha/beta |
Superfamily d.74.2: C-terminal domain of arginine repressor [55252] (2 families) forms trimers with three closely packed beta-sheets |
Family d.74.2.1: C-terminal domain of arginine repressor [55253] (1 protein) automatically mapped to Pfam PF02863 |
Protein C-terminal domain of arginine repressor [55254] (3 species) |
Species Bacillus stearothermophilus [TaxId:1422] [55256] (2 PDB entries) |
Domain d1b4bb_: 1b4b B: [39719] complexed with arg |
PDB Entry: 1b4b (more details), 2.2 Å
SCOPe Domain Sequences for d1b4bb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1b4bb_ d.74.2.1 (B:) C-terminal domain of arginine repressor {Bacillus stearothermophilus [TaxId: 1422]} alvdvfikldgtgnllvlrtlpgnahaigvlldnldwdeivgticgddtcliicrtpkda kkvsnqllsml
Timeline for d1b4bb_: