Lineage for d1b4bb_ (1b4b B:)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2958012Fold d.74: DCoH-like [55247] (5 superfamilies)
    beta(2)-alpha-beta(2)-alpha; 2 layers, alpha/beta
  4. 2958075Superfamily d.74.2: C-terminal domain of arginine repressor [55252] (2 families) (S)
    forms trimers with three closely packed beta-sheets
  5. 2958076Family d.74.2.1: C-terminal domain of arginine repressor [55253] (1 protein)
    automatically mapped to Pfam PF02863
  6. 2958077Protein C-terminal domain of arginine repressor [55254] (3 species)
  7. 2958078Species Bacillus stearothermophilus [TaxId:1422] [55256] (2 PDB entries)
  8. 2958080Domain d1b4bb_: 1b4b B: [39719]
    complexed with arg

Details for d1b4bb_

PDB Entry: 1b4b (more details), 2.2 Å

PDB Description: structure of the oligomerization domain of the arginine repressor from bacillus stearothermophilus
PDB Compounds: (B:) Arginine repressor

SCOPe Domain Sequences for d1b4bb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1b4bb_ d.74.2.1 (B:) C-terminal domain of arginine repressor {Bacillus stearothermophilus [TaxId: 1422]}
alvdvfikldgtgnllvlrtlpgnahaigvlldnldwdeivgticgddtcliicrtpkda
kkvsnqllsml

SCOPe Domain Coordinates for d1b4bb_:

Click to download the PDB-style file with coordinates for d1b4bb_.
(The format of our PDB-style files is described here.)

Timeline for d1b4bb_: