PDB entry 1b4b
View 1b4b on RCSB PDB site
Description: structure of the oligomerization domain of the arginine repressor from bacillus stearothermophilus
Class: repressor
Keywords: repressor, arginine, core, oligomerization domain, helix turn helix
Deposited on
1998-12-18, released
1999-06-15
The last revision prior to the SCOPe 2.08 freeze date was dated
2011-11-16, with a file datestamp of
2011-11-11.
Experiment type: XRAY
Resolution: 2.2 Å
R-factor: 0.218
AEROSPACI score: 0.34
(click here for full SPACI score report)
Chains and heterogens:
- Chain 'A':
Compound: Arginine repressor
Species: Geobacillus stearothermophilus [TaxId:1422]
Database cross-references and differences (RAF-indexed):
Domains in SCOPe 2.08: d1b4ba_ - Chain 'B':
Compound: Arginine repressor
Species: Geobacillus stearothermophilus [TaxId:1422]
Database cross-references and differences (RAF-indexed):
Domains in SCOPe 2.08: d1b4bb_ - Chain 'C':
Compound: Arginine repressor
Species: Geobacillus stearothermophilus [TaxId:1422]
Database cross-references and differences (RAF-indexed):
Domains in SCOPe 2.08: d1b4bc_ - Heterogens: ARG, HOH
PDB Chain Sequences:
- Chain 'A':
Sequence; same for both SEQRES and ATOM records: (download)
>1b4bA (A:)
alvdvfikldgtgnllvlrtlpgnahaigvlldnldwdeivgticgddtcliicrtpkda
kkvsnqllsml
- Chain 'B':
Sequence; same for both SEQRES and ATOM records: (download)
>1b4bB (B:)
alvdvfikldgtgnllvlrtlpgnahaigvlldnldwdeivgticgddtcliicrtpkda
kkvsnqllsml
- Chain 'C':
Sequence; same for both SEQRES and ATOM records: (download)
>1b4bC (C:)
alvdvfikldgtgnllvlrtlpgnahaigvlldnldwdeivgticgddtcliicrtpkda
kkvsnqllsml