PDB entry 1b4b

View 1b4b on RCSB PDB site
Description: structure of the oligomerization domain of the arginine repressor from bacillus stearothermophilus
Class: repressor
Keywords: repressor, arginine, core, oligomerization domain, helix turn helix
Deposited on 1998-12-18, released 1999-06-15
The last revision prior to the SCOPe 2.08 freeze date was dated 2011-11-16, with a file datestamp of 2011-11-11.
Experiment type: XRAY
Resolution: 2.2 Å
R-factor: 0.218
AEROSPACI score: 0.34 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Arginine repressor
    Species: Geobacillus stearothermophilus [TaxId:1422]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d1b4ba_
  • Chain 'B':
    Compound: Arginine repressor
    Species: Geobacillus stearothermophilus [TaxId:1422]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d1b4bb_
  • Chain 'C':
    Compound: Arginine repressor
    Species: Geobacillus stearothermophilus [TaxId:1422]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d1b4bc_
  • Heterogens: ARG, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1b4bA (A:)
    alvdvfikldgtgnllvlrtlpgnahaigvlldnldwdeivgticgddtcliicrtpkda
    kkvsnqllsml
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1b4bB (B:)
    alvdvfikldgtgnllvlrtlpgnahaigvlldnldwdeivgticgddtcliicrtpkda
    kkvsnqllsml
    

  • Chain 'C':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1b4bC (C:)
    alvdvfikldgtgnllvlrtlpgnahaigvlldnldwdeivgticgddtcliicrtpkda
    kkvsnqllsml