PDB entry 1b4b

View 1b4b on RCSB PDB site
Description: structure of the oligomerization domain of the arginine repressor from bacillus stearothermophilus
Class: repressor
Keywords: repressor, arginine, core, oligomerization domain, helix turn helix
Deposited on 1998-12-18, released 1999-06-15
The last revision prior to the SCOPe 2.08 freeze date was dated 2011-11-16, with a file datestamp of 2011-11-11.
Experiment type: XRAY
Resolution: 2.2 Å
R-factor: 0.218
AEROSPACI score: 0.34 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: Arginine repressor
  Species: Geobacillus stearothermophilus [TaxId:1422]
  Database cross-references and differences (RAF-indexed):
  • Uniprot O31408 (0-70)
  Domains in SCOPe 2.08: d1b4ba_
• Chain 'B':
  Compound: Arginine repressor
  Species: Geobacillus stearothermophilus [TaxId:1422]
  Database cross-references and differences (RAF-indexed):
  • Uniprot O31408 (0-70)
  Domains in SCOPe 2.08: d1b4bb_
• Chain 'C':
  Compound: Arginine repressor
  Species: Geobacillus stearothermophilus [TaxId:1422]
  Database cross-references and differences (RAF-indexed):
  • Uniprot O31408 (0-70)
  Domains in SCOPe 2.08: d1b4bc_
• Heterogens: ARG, HOH

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1b4bA (A:)
  alvdvfikldgtgnllvlrtlpgnahaigvlldnldwdeivgticgddtcliicrtpkda
  kkvsnqllsml
  

  
  
• Chain 'B':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1b4bB (B:)
  alvdvfikldgtgnllvlrtlpgnahaigvlldnldwdeivgticgddtcliicrtpkda
  kkvsnqllsml
  

  
  
• Chain 'C':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1b4bC (C:)
  alvdvfikldgtgnllvlrtlpgnahaigvlldnldwdeivgticgddtcliicrtpkda
  kkvsnqllsml