Lineage for d6zn0a_ (6zn0 A:)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2979545Fold d.144: Protein kinase-like (PK-like) [56111] (1 superfamily)
    consists of two alpha+beta domains, C-terminal domain is mostly alpha helical
  4. 2979546Superfamily d.144.1: Protein kinase-like (PK-like) [56112] (8 families) (S)
    shares functional and structural similarities with the ATP-grasp fold and PIPK
  5. 2979693Family d.144.1.7: Protein kinases, catalytic subunit [88854] (66 proteins)
    members organized in the groups and subfamiles specified by the comments
  6. 2980113Protein cAMP-dependent PK, catalytic subunit [56116] (7 species)
    AGC group; PKA subfamily; serine/threonine kinase
  7. 2980116Species Chinese hamster (Cricetulus griseus) [TaxId:10029] [346668] (33 PDB entries)
  8. 2980142Domain d6zn0a_: 6zn0 A: [396758]
    automated match to d1smha_
    complexed with dms, mrd, ntn

Details for d6zn0a_

PDB Entry: 6zn0 (more details), 1.59 Å

PDB Description: crystal structure of camp-dependent protein kinase a (cho pka) in complex with isonicotinamidine
PDB Compounds: (A:) cAMP-dependent protein kinase catalytic subunit alpha

SCOPe Domain Sequences for d6zn0a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d6zn0a_ d.144.1.7 (A:) cAMP-dependent PK, catalytic subunit {Chinese hamster (Cricetulus griseus) [TaxId: 10029]}
esvkeflakakeeflkkwespsqntaqldhfdriktlgtgsfgrvmlvkhketgnhyamk
ildkqkvvklkqiehtlnekrilqavnfpflvklefsfkdnsnlymvmeyvpggemfshl
rrigrfsepharfyaaqivltfeylhsldliyrdlkpenllidqqgyiqvtdfgfakrvk
grtwtlcgtpeylapeiilskgynkavdwwalgvliyemaagyppffadqpiqiyekivs
gkvrfpshfssdlkdllrnllqvdltkrfgnlkngvndiknhkwfattdwiaiyqrkvea
pfipkfkgpgdtsnfddyeeeeirvsinekcgkeftef

SCOPe Domain Coordinates for d6zn0a_:

Click to download the PDB-style file with coordinates for d6zn0a_.
(The format of our PDB-style files is described here.)

Timeline for d6zn0a_: