Lineage for d1smha_ (1smh A:)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2979545Fold d.144: Protein kinase-like (PK-like) [56111] (1 superfamily)
    consists of two alpha+beta domains, C-terminal domain is mostly alpha helical
  4. 2979546Superfamily d.144.1: Protein kinase-like (PK-like) [56112] (8 families) (S)
    shares functional and structural similarities with the ATP-grasp fold and PIPK
  5. 2979693Family d.144.1.7: Protein kinases, catalytic subunit [88854] (66 proteins)
    members organized in the groups and subfamiles specified by the comments
  6. 2980113Protein cAMP-dependent PK, catalytic subunit [56116] (7 species)
    AGC group; PKA subfamily; serine/threonine kinase
  7. 2980149Species Cow (Bos taurus) [TaxId:9913] [56118] (40 PDB entries)
    Uniprot P00517
  8. 2980162Domain d1smha_: 1smh A: [105757]
    complexed with bu3, mg8

Details for d1smha_

PDB Entry: 1smh (more details), 2.04 Å

PDB Description: protein kinase a variant complex with completely ordered n-terminal helix
PDB Compounds: (A:) cAMP-dependent protein kinase, alpha-catalytic subunit

SCOPe Domain Sequences for d1smha_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1smha_ d.144.1.7 (A:) cAMP-dependent PK, catalytic subunit {Cow (Bos taurus) [TaxId: 9913]}
gnaaaakkgseqesvkeflakakedflkkwenpaqntahldqferiktlgtgsfgrvmlv
khmetgnhyamkildkqkvvklkeiehtlnekrilqavnfpflvklefsfkdnsnlymvm
eyapggemfshlrrigrfsepharfyaaqivltfeylhsldliyrdlkpenlmidqqgyi
qvtdfglakrvkgrtwtlcgtpeylapeiilskgynkavdwwalgvliyemaagyppffa
dqpiqiyekivsgkvrfpshfssdlkdllrnllqvdltkrfgnlkngvndiknhkwfatt
dwiaiyqrkveapfipkfkgpgdtsnfddyeeeeirvsinekcgkefsef

SCOPe Domain Coordinates for d1smha_:

Click to download the PDB-style file with coordinates for d1smha_.
(The format of our PDB-style files is described here.)

Timeline for d1smha_: