Class d: Alpha and beta proteins (a+b) [53931] (388 folds) |
Fold d.144: Protein kinase-like (PK-like) [56111] (1 superfamily) consists of two alpha+beta domains, C-terminal domain is mostly alpha helical |
Superfamily d.144.1: Protein kinase-like (PK-like) [56112] (8 families) shares functional and structural similarities with the ATP-grasp fold and PIPK |
Family d.144.1.7: Protein kinases, catalytic subunit [88854] (66 proteins) members organized in the groups and subfamiles specified by the comments |
Protein cAMP-dependent PK, catalytic subunit [56116] (7 species) AGC group; PKA subfamily; serine/threonine kinase |
Species Cricetulus griseus [TaxId:10029] [346668] (32 PDB entries) |
Domain d6zn0a_: 6zn0 A: [396758] automated match to d1smha_ complexed with dms, mrd, ntn |
PDB Entry: 6zn0 (more details), 1.59 Å
SCOPe Domain Sequences for d6zn0a_:
Sequence; same for both SEQRES and ATOM records: (download)
>d6zn0a_ d.144.1.7 (A:) cAMP-dependent PK, catalytic subunit {Cricetulus griseus [TaxId: 10029]} esvkeflakakeeflkkwespsqntaqldhfdriktlgtgsfgrvmlvkhketgnhyamk ildkqkvvklkqiehtlnekrilqavnfpflvklefsfkdnsnlymvmeyvpggemfshl rrigrfsepharfyaaqivltfeylhsldliyrdlkpenllidqqgyiqvtdfgfakrvk grtwtlcgtpeylapeiilskgynkavdwwalgvliyemaagyppffadqpiqiyekivs gkvrfpshfssdlkdllrnllqvdltkrfgnlkngvndiknhkwfattdwiaiyqrkvea pfipkfkgpgdtsnfddyeeeeirvsinekcgkeftef
Timeline for d6zn0a_: