| Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
| Fold d.73: RuBisCO, small subunit [55238] (1 superfamily) alpha-beta(2)-alpha-beta(2); 2 layers, alpha/beta |
Superfamily d.73.1: RuBisCO, small subunit [55239] (2 families) ![]() |
| Family d.73.1.1: RuBisCO, small subunit [55240] (2 proteins) |
| Protein Ribulose 1,5-bisphosphate carboxylase-oxygenase [55241] (9 species) |
| Species Spinach (Spinacia oleracea) [TaxId:3562] [55243] (10 PDB entries) |
| Domain d1rcoi_: 1rco I: [39649] Other proteins in same PDB: d1rcob1, d1rcob2, d1rcoe1, d1rcoe2, d1rcoh1, d1rcoh2, d1rcok1, d1rcok2, d1rcol1, d1rcol2, d1rcoo1, d1rcoo2, d1rcor1, d1rcor2, d1rcov1, d1rcov2 complexed with xdp |
PDB Entry: 1rco (more details), 2.3 Å
SCOPe Domain Sequences for d1rcoi_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1rcoi_ d.73.1.1 (I:) Ribulose 1,5-bisphosphate carboxylase-oxygenase {Spinach (Spinacia oleracea) [TaxId: 3562]}
mqvwpilnlkkyetlsylpplttdqlarqvdyllnnkwvpclefetdhgfvyrehhnspg
yydgrywtmwklpmfgctdpaqvlneleeckkeypnafiriigfdsnrevqcisfiaykp
agy
Timeline for d1rcoi_: