Lineage for d1rcoo1 (1rco O:148-475)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2826025Fold c.1: TIM beta/alpha-barrel [51350] (34 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 2838499Superfamily c.1.14: RuBisCo, C-terminal domain [51649] (2 families) (S)
    automatically mapped to Pfam PF00016
  5. 2838500Family c.1.14.1: RuBisCo, large subunit, C-terminal domain [51650] (2 proteins)
    N-terminal domain is alpha+beta
  6. 2838501Protein Ribulose 1,5-bisphosphate carboxylase-oxygenase [51651] (14 species)
  7. 2838627Species Spinach (Spinacia oleracea) [TaxId:3562] [51653] (11 PDB entries)
  8. 2838657Domain d1rcoo1: 1rco O:148-475 [29361]
    Other proteins in same PDB: d1rcob2, d1rcoc_, d1rcoe2, d1rcof_, d1rcoh2, d1rcoi_, d1rcok2, d1rcol2, d1rcom_, d1rcoo2, d1rcop_, d1rcor2, d1rcos_, d1rcot_, d1rcov2, d1rcow_
    complexed with xdp

Details for d1rcoo1

PDB Entry: 1rco (more details), 2.3 Å

PDB Description: spinach rubisco in complex with the inhibitor d-xylulose-2,2-diol-1,5-bisphosphate
PDB Compounds: (O:) ribulose bisphosphate carboxylase/oxygenase

SCOPe Domain Sequences for d1rcoo1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1rcoo1 c.1.14.1 (O:148-475) Ribulose 1,5-bisphosphate carboxylase-oxygenase {Spinach (Spinacia oleracea) [TaxId: 3562]}
fqgpphgiqverdklnkygrpllgctikpklglsaknygravyeclrggldftkddenvn
sqpfmrwrdrflfcaealykaqaetgeikghylnatagtcedmmkravfarelgvpivmh
dyltggftanttlshycrdnglllhihramhavidrqknhgmhfrvlakalrlsggdhih
sgtvvgklegerditlgfvdllrddytekdrsrgiyftqswvstpgvlpvasggihvwhm
palteifgddsvlqfgggtlghpwgnapgavanrvaleacvqarnegrdlaregntiire
atkwspelaaacevwkeikfefpamdtv

SCOPe Domain Coordinates for d1rcoo1:

Click to download the PDB-style file with coordinates for d1rcoo1.
(The format of our PDB-style files is described here.)

Timeline for d1rcoo1: