Lineage for d1rcol2 (1rco L:9-147)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2949054Fold d.58: Ferredoxin-like [54861] (62 superfamilies)
    alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2
  4. 2952777Superfamily d.58.9: RuBisCO, large subunit, small (N-terminal) domain [54966] (2 families) (S)
    C-terminal domain is beta/alpha barrel
  5. 2952778Family d.58.9.1: Ribulose 1,5-bisphosphate carboxylase-oxygenase [54967] (1 protein)
  6. 2952779Protein Ribulose 1,5-bisphosphate carboxylase-oxygenase [54968] (13 species)
  7. 2952895Species Spinach (Spinacia oleracea) [TaxId:3562] [54970] (11 PDB entries)
  8. 2952924Domain d1rcol2: 1rco L:9-147 [39262]
    Other proteins in same PDB: d1rcob1, d1rcoc_, d1rcoe1, d1rcof_, d1rcoh1, d1rcoi_, d1rcok1, d1rcol1, d1rcom_, d1rcoo1, d1rcop_, d1rcor1, d1rcos_, d1rcot_, d1rcov1, d1rcow_
    complexed with xdp

Details for d1rcol2

PDB Entry: 1rco (more details), 2.3 Å

PDB Description: spinach rubisco in complex with the inhibitor d-xylulose-2,2-diol-1,5-bisphosphate
PDB Compounds: (L:) ribulose bisphosphate carboxylase/oxygenase

SCOPe Domain Sequences for d1rcol2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1rcol2 d.58.9.1 (L:9-147) Ribulose 1,5-bisphosphate carboxylase-oxygenase {Spinach (Spinacia oleracea) [TaxId: 3562]}
asvgfkagvkdykltyytpeyetldtdilaafrvspqpgvppeeagaavaaesstgtwtt
vwtdgltnldrykgrcyhiepvageenqyicyvaypldlfeegsvtnmftsivgnvfgfk
alralrledlripvayvkt

SCOPe Domain Coordinates for d1rcol2:

Click to download the PDB-style file with coordinates for d1rcol2.
(The format of our PDB-style files is described here.)

Timeline for d1rcol2: