Lineage for d6ycgb_ (6ycg B:)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2926589Fold d.3: Cysteine proteinases [54000] (1 superfamily)
    consists of one alpha-helix and 4 strands of antiparallel beta-sheet and contains the catalytic triad Cys-His-Asn
  4. 2926590Superfamily d.3.1: Cysteine proteinases [54001] (24 families) (S)
    the constitute families differ by insertion into and circular permutation of the common catalytic core made of one alpha-helix and 3-strands of beta-sheet
  5. 2927640Family d.3.1.0: automated matches [191342] (1 protein)
    not a true family
  6. 2927641Protein automated matches [190230] (23 species)
    not a true protein
  7. 2927798Species Pineapple (Ananas comosus) [TaxId:4615] [358316] (10 PDB entries)
  8. 2927808Domain d6ycgb_: 6ycg B: [396467]
    automated match to d1iwda_
    complexed with cit, ipa, tck

Details for d6ycgb_

PDB Entry: 6ycg (more details), 1.45 Å

PDB Description: structure the bromelain protease from ananas comosus in complex with the tlck inhibitor
PDB Compounds: (B:) fbsb

SCOPe Domain Sequences for d6ycgb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d6ycgb_ d.3.1.0 (B:) automated matches {Pineapple (Ananas comosus) [TaxId: 4615]}
vpqsidwrdygavtsvknqnpcgacwafaaiatvesiykikkgileplseqqvldcakgy
gckggwefrafefiisnkgvasgaiypykaakgtcktngvpnsayitgyarvprnnessm
myavskqpitvavdananfqyyksgvfngpcgtslnhavtaigygqdsngkkywivknsw
garwgeagyirmardvssssgicgiaidslyptle

SCOPe Domain Coordinates for d6ycgb_:

Click to download the PDB-style file with coordinates for d6ycgb_.
(The format of our PDB-style files is described here.)

Timeline for d6ycgb_: