SCOPe 2.08: Domain d6ycga_: 6ycg A:

Lineage for d6ycga_ (6ycg A:)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.3: Cysteine proteinases [54000] (1 superfamily)
   consists of one alpha-helix and 4 strands of antiparallel beta-sheet and contains the catalytic triad Cys-His-Asn

4. Superfamily d.3.1: Cysteine proteinases [54001] (24 families)
   the constitute families differ by insertion into and circular permutation of the common catalytic core made of one alpha-helix and 3-strands of beta-sheet

5. Family d.3.1.0: automated matches [191342] (1 protein)
   not a true family

6. Protein automated matches [190230] (23 species)
   not a true protein

7. Species Pineapple (Ananas comosus) [TaxId:4615] [358316] (10 PDB entries)

8. Domain d6ycga_: 6ycg A: [396473]
   automated match to d1iwda_
   complexed with cit, ipa, tck

Details for d6ycga_

PDB Entry: 6ycg, 1.45 Å

PDB Description: structure the bromelain protease from ananas comosus in complex with the tlck inhibitor

PDB Compounds: (A:) fbsb

SCOPe Domain Sequences for d6ycga_:

Sequence; same for both SEQRES and ATOM records:

>d6ycga_ d.3.1.0 (A:) automated matches {Pineapple (Ananas comosus) [TaxId: 4615]}
vpqsidwrdygavtsvknqnpcgacwafaaiatvesiykikkgileplseqqvldcakgy
gckggwefrafefiisnkgvasgaiypykaakgtcktngvpnsayitgyarvprnnessm
myavskqpitvavdananfqyyksgvfngpcgtslnhavtaigygqdsngkkywivknsw
garwgeagyirmardvssssgicgiaidslyptle

Timeline for d6ycga_:

• d6ycga_ first appeared in SCOPe 2.07