Lineage for d6wm2d1 (6wm2 D:39-117)

  1. Root: SCOPe 2.07
  2. 2352458Class b: All beta proteins [48724] (178 folds)
  3. 2408137Fold b.49: Domain of alpha and beta subunits of F1 ATP synthase-like [50614] (4 superfamilies)
    barrel, closed; n=6, S=8; greek-key
    Many cradle-loop superfamilies may be homologous, according to PubMed 18457946
  4. 2408138Superfamily b.49.1: N-terminal domain of alpha and beta (or A/B) subunits of rotary ATPases [50615] (3 families) (S)
    automatically mapped to Pfam PF02874
  5. 2408357Family b.49.1.0: automated matches [254232] (1 protein)
    not a true family
  6. 2408358Protein automated matches [254527] (17 species)
    not a true protein
  7. 2408455Species Homo sapiens [TaxId:9606] [396077] (2 PDB entries)
  8. 2408459Domain d6wm2d1: 6wm2 D:39-117 [396284]
    Other proteins in same PDB: d6wm2d2, d6wm2d3, d6wm2e2, d6wm2e3, d6wm2f2, d6wm2f3, d6wm2g_, d6wm2n_, d6wm2q_
    automated match to d3gqbb1
    complexed with adp, clr, nag, psf, pty, wjp, wjs, wss

Details for d6wm2d1

PDB Entry: 6wm2 (more details), 3.1 Å

PDB Description: human v-atpase in state 1 with sidk and adp
PDB Compounds: (D:) V-type proton ATPase subunit B, brain isoform

SCOPe Domain Sequences for d6wm2d1:

Sequence; same for both SEQRES and ATOM records: (download)

>d6wm2d1 b.49.1.0 (D:39-117) automated matches {Homo sapiens [TaxId: 9606]}
ylsqprltyktvsgvngplvildhvkfpryaeivhltlpdgtkrsgqvlevsgskavvqv
fegtsgidakktsceftgd

SCOPe Domain Coordinates for d6wm2d1:

Click to download the PDB-style file with coordinates for d6wm2d1.
(The format of our PDB-style files is described here.)

Timeline for d6wm2d1: