Class a: All alpha proteins [46456] (289 folds) |
Fold a.69: Left-handed superhelix [47916] (4 superfamilies) core: 4-5 helices; bundle; left-handed superhelix |
Superfamily a.69.1: C-terminal domain of alpha and beta (or A/B) subunits of rotary ATPases [47917] (3 families) |
Family a.69.1.0: automated matches [254233] (1 protein) not a true family |
Protein automated matches [254528] (17 species) not a true protein |
Species Homo sapiens [TaxId:9606] [396080] (2 PDB entries) |
Domain d6wm2d3: 6wm2 D:402-506 [396286] Other proteins in same PDB: d6wm2d1, d6wm2d2, d6wm2e1, d6wm2e2, d6wm2f1, d6wm2f2, d6wm2g_, d6wm2n_, d6wm2q_ automated match to d3gqbb3 complexed with adp, clr, nag, psf, pty, wjp, wjs, wss |
PDB Entry: 6wm2 (more details), 3.1 Å
SCOPe Domain Sequences for d6wm2d3:
Sequence; same for both SEQRES and ATOM records: (download)
>d6wm2d3 a.69.1.0 (D:402-506) automated matches {Homo sapiens [TaxId: 9606]} mksaigegmtrkdhadvsnqlyacyaigkdvqamkavvgeealtsddllyleflqkfern fiaqgpyenrtvfetldigwqllrifpkemlkripqstlsefypr
Timeline for d6wm2d3: