SCOP 1.65: Domain d1ej7s_: 1ej7 S:

Lineage for d1ej7s_ (1ej7 S:)

1. Root: SCOP 1.65

2. Class d: Alpha and beta proteins (a+b) [53931] (234 folds)

3. Fold d.73: RuBisCO, small subunit [55238] (1 superfamily)
   alpha-beta(2)-alpha-beta(2); 2 layers, alpha/beta

4. Superfamily d.73.1: RuBisCO, small subunit [55239] (1 family)

5. Family d.73.1.1: RuBisCO, small subunit [55240] (1 protein)

6. Protein Ribulose 1,5-bisphosphate carboxylase-oxygenase [55241] (6 species)

7. Species Tobacco (Nicotiana tabacum), variant turkish samsun [TaxId:4097] [55242] (5 PDB entries)

8. Domain d1ej7s_: 1ej7 S: [39617]
   Other proteins in same PDB: d1ej7l1, d1ej7l2
   complexed with po4

Details for d1ej7s_

PDB Entry: 1ej7, 2.45 Å

PDB Description: crystal structure of unactivated tobacco rubisco with bound phosphate ions

SCOP Domain Sequences for d1ej7s_:

Sequence; same for both SEQRES and ATOM records:

>d1ej7s_ d.73.1.1 (S:) Ribulose 1,5-bisphosphate carboxylase-oxygenase {Tobacco (Nicotiana tabacum), variant turkish samsun}
mqvwppinkkkyetlsylpdlsqeqllseveyllkngwvpclefetehgfvyrennkspg
yydgrywtmwklpmfgctdatqvlaeveeakkaypqawiriigfdnvrqvqcisfiaykp
egy

Timeline for d1ej7s_:

• d1ej7s_ first appeared (with stable ids) in SCOP 1.55
  
• d1ej7s_ appears in SCOP 1.63
  
• d1ej7s_ appears in SCOP 1.67
  
• d1ej7s_ appears in the current release, SCOPe 2.08