Lineage for d1ej7s_ (1ej7 S:)

  1. Root: SCOPe 2.07
  2. 2494617Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2524228Fold d.73: RuBisCO, small subunit [55238] (1 superfamily)
    alpha-beta(2)-alpha-beta(2); 2 layers, alpha/beta
  4. 2524229Superfamily d.73.1: RuBisCO, small subunit [55239] (2 families) (S)
  5. 2524230Family d.73.1.1: RuBisCO, small subunit [55240] (2 proteins)
  6. 2524231Protein Ribulose 1,5-bisphosphate carboxylase-oxygenase [55241] (8 species)
  7. 2524378Species Tobacco (Nicotiana tabacum), variant turkish samsun [TaxId:4097] [55242] (5 PDB entries)
  8. 2524380Domain d1ej7s_: 1ej7 S: [39617]
    Other proteins in same PDB: d1ej7l1, d1ej7l2
    complexed with po4

Details for d1ej7s_

PDB Entry: 1ej7 (more details), 2.45 Å

PDB Description: crystal structure of unactivated tobacco rubisco with bound phosphate ions
PDB Compounds: (S:) rubisco (small subunit)

SCOPe Domain Sequences for d1ej7s_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ej7s_ d.73.1.1 (S:) Ribulose 1,5-bisphosphate carboxylase-oxygenase {Tobacco (Nicotiana tabacum), variant turkish samsun [TaxId: 4097]}
mqvwppinkkkyetlsylpdlsqeqllseveyllkngwvpclefetehgfvyrennkspg
yydgrywtmwklpmfgctdatqvlaeveeakkaypqawiriigfdnvrqvqcisfiaykp
egy

SCOPe Domain Coordinates for d1ej7s_:

Click to download the PDB-style file with coordinates for d1ej7s_.
(The format of our PDB-style files is described here.)

Timeline for d1ej7s_: