Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
Fold d.73: RuBisCO, small subunit [55238] (1 superfamily) alpha-beta(2)-alpha-beta(2); 2 layers, alpha/beta |
Superfamily d.73.1: RuBisCO, small subunit [55239] (2 families) |
Family d.73.1.1: RuBisCO, small subunit [55240] (2 proteins) |
Protein Ribulose 1,5-bisphosphate carboxylase-oxygenase [55241] (9 species) |
Species Tobacco (Nicotiana tabacum), variant turkish samsun [TaxId:4097] [55242] (5 PDB entries) |
Domain d1ej7s_: 1ej7 S: [39617] Other proteins in same PDB: d1ej7l1, d1ej7l2 complexed with po4 |
PDB Entry: 1ej7 (more details), 2.45 Å
SCOPe Domain Sequences for d1ej7s_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1ej7s_ d.73.1.1 (S:) Ribulose 1,5-bisphosphate carboxylase-oxygenase {Tobacco (Nicotiana tabacum), variant turkish samsun [TaxId: 4097]} mqvwppinkkkyetlsylpdlsqeqllseveyllkngwvpclefetehgfvyrennkspg yydgrywtmwklpmfgctdatqvlaeveeakkaypqawiriigfdnvrqvqcisfiaykp egy
Timeline for d1ej7s_: